PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_898_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 238aa    MW: 26795.7 Da    PI: 7.8283
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_898_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-082267245
                     SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                       WT eE +++ +a ++l  +    +++Ia +++ g++l q+k++++
     Neem_898_f_2 22 TEWTWEENKKFENALAELDLEsphLFELIALRVP-GKSLSQIKEHYN 67
                     68*****************999999*********.***********8 PP

2Myb_DNA-binding43.95.6e-14132176347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT eE+el++++ + +G g+W++I+r+   ++t+ q+ s+ qk+
     Neem_898_f_2 132 PWTSEEHELFLQGLQIYGRGDWRSISRHCVRTKTPIQIASHAQKH 176
                      7****************************99************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.3631974IPR017884SANT domain
SMARTSM007174.6E-82072IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-42070IPR009057Homeodomain-like
SuperFamilySSF466897.9E-82276IPR009057Homeodomain-like
PfamPF002492.4E-62268IPR001005SANT/Myb domain
CDDcd001673.80E-62370No hitNo description
PROSITE profilePS5129417.645124181IPR017930Myb domain
SuperFamilySSF466892.62E-17126182IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-15128179IPR006447Myb domain, plants
SMARTSM007171.2E-9129179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-10130176IPR009057Homeodomain-like
CDDcd001676.43E-10132177No hitNo description
PfamPF002491.7E-10132176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MESSHSHSQS QSMLSLSNSE KTEWTWEENK KFENALAELD LESPHLFELI ALRVPGKSLS  60
QIKEHYNALV EDIQLIEADL VPLPNYKNNV KGKGHVTEAE TRTHNKTVNK GKGRVLEAEK  120
KTSNQSRKKG IPWTSEEHEL FLQGLQIYGR GDWRSISRHC VRTKTPIQIA SHAQKHFIRL  180
QKQNSGANNK VDSASTPNNE ISTAANNTAC HQLSSGSSFA DASDIAGQYF PSDYWNHF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009362.14e-53PREDICTED: transcription factor DIVARICATA-like
TrEMBLB9HH202e-51B9HH20_POPTR; Uncharacterized protein
STRINGPOPTR_0007s08530.16e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-46MYB family protein